PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17295-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 297aa    MW: 30784.6 Da    PI: 5.2754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17295-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-182772148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgr+T +E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
  TRIUR3_17295-P1 27 RGRFTDDEEKLIIHLHSLLGNK-WSSIATKLP-GRTDNEIKNYWNTHL 72
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.5142276IPR017930Myb domain
SMARTSM007171.8E-152674IPR001005SANT/Myb domain
PfamPF002491.8E-162772IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-142777IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-232873IPR009057Homeodomain-like
CDDcd001675.24E-132972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRAPCCDGE AGVKKGPWTP EEDKLLRGRF TDDEEKLIIH LHSLLGNKWS SIATKLPGRT  60
DNEIKNYWNT HLRKKLLGMG IDPVTHRPRT DLSLLAGLPG LLAAAGNFGG AGSATGAWDM  120
NALRLQADAA KFQLLQGLVR ALTTAAVPAP APGMDNLMAL LAASSGGQSG MNNGGQHGVD  180
QSMLLQQCQW DGMNNLPALT NSAPASGMHN ISGMFDGFGA GDGLSSTELG CHGGASGSNV  240
TVDAVAPPRP MVANDQECNN NGGGGVSCEQ TPASSPFDGL ESLNLMDDLN TDGKCHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276659e-68KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964317.17e-97PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP05e-46MYB39_ARATH; Transcription factor MYB39
TrEMBLM7ZPE60.0M7ZPE6_TRIUA; Transcription factor MYB39
STRINGSi006790m2e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.13e-41myb domain protein 107